SCOPe 2.01: Domain d3a5ua_: 3a5u A:

Lineage for d3a5ua_ (3a5u A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein automated matches [190206] (3 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [189407] (1 PDB entry)

8. Domain d3a5ua_: 3a5u A: [171758]
   automated match to d1ue1b_
   protein/DNA complex

Details for d3a5ua_

PDB Entry: 3a5u, 2.8 Å

PDB Description: Promiscuity and specificity in DNA binding to SSB: Insights from the structure of the Mycobacterium smegmatis SSB-ssDNA complex

PDB Compounds: (A:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d3a5ua_:

Sequence, based on SEQRES records:

>d3a5ua_ b.40.4.3 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
magdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniw
reaaenvaesltrgsrvivtgrlkqrsfetregekrtvvevevdeigpslryatakvnk

Sequence, based on observed residues (ATOM records):

>d3a5ua_ b.40.4.3 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
magdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniw
reaaenvaesltrgsrvivtgrlkqrsftregekrtvvevevdeigpslryatakvnk

Timeline for d3a5ua_:

• d3a5ua_ is new in SCOPe 2.01-stable
  
• d3a5ua_ appears in SCOPe 2.02
  
• d3a5ua_ appears in the current release, SCOPe 2.08