Lineage for d2zc4f1 (2zc4 F:626-692)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536656Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. 2536657Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (2 families) (S)
    duplication: consists of 2 subdomains of this fold
  5. 2536658Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)
  6. 2536659Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)
  7. 2536660Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries)
  8. 2536671Domain d2zc4f1: 2zc4 F:626-692 [154334]
    Other proteins in same PDB: d2zc4b_, d2zc4e_
    automated match to d2zc4f1
    complexed with so4, teb

Details for d2zc4f1

PDB Entry: 2zc4 (more details), 2.8 Å

PDB Description: Penicillin-binding protein 2X (PBP 2X) acyl-enzyme complex (tebipenem) from Streptococcus pneumoniae
PDB Compounds: (F:) penicillin-binding protein 2x

SCOPe Domain Sequences for d2zc4f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zc4f1 d.11.1.1 (F:626-692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
aleqvsqqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapnqq
vlilsdk

SCOPe Domain Coordinates for d2zc4f1:

Click to download the PDB-style file with coordinates for d2zc4f1.
(The format of our PDB-style files is described here.)

Timeline for d2zc4f1: