| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily) alpha1-beta3; 2 layers: alpha/beta; order 132 |
Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (2 families) ![]() duplication: consists of 2 subdomains of this fold |
| Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein) |
| Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species) |
| Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries) |
| Domain d2zc4f1: 2zc4 F:626-692 [154334] Other proteins in same PDB: d2zc4b_, d2zc4e_ automated match to d2zc4f1 complexed with so4, teb |
PDB Entry: 2zc4 (more details), 2.8 Å
SCOPe Domain Sequences for d2zc4f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zc4f1 d.11.1.1 (F:626-692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
aleqvsqqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapnqq
vlilsdk
Timeline for d2zc4f1:
View in 3DDomains from other chains: (mouse over for more information) d2zc4b_, d2zc4c1, d2zc4c2, d2zc4e_ |