Lineage for d2z8la2 (2z8l A:101-204)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) 
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) 
Protein Superantigen-like protein SET3 [75370] (1 species) Species Staphylococcus aureus [TaxId:1280] [75371] (3 PDB entries) 
Domain d2z8la2: 2z8l A:101-204 [154210]
Other proteins in same PDB: d2z8la1
automated match to d2z8la2
complexed with gol, po4
Details for d2z8la2
PDB Entry: 2z8l (more details), 1.65 Å
PDB Description: crystal structure of the staphylococcal superantigen-like protein ssl5 at ph 4.6 complexed with sialyl lewis x
PDB Compounds: (A:) Exotoxin 3SCOPe Domain Sequences for d2z8la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z8la2 d.15.6.1 (A:101-204) Superantigen-like protein SET3 {Staphylococcus aureus [TaxId: 1280]}
ayydylnapkfvikkevdagvythvkrhyiykeevslkeldfklrqyliqnfdlykkfpk
dskikvimkdggyytfelnkklqphrmsdvidgrniekmeanir
SCOPe Domain Coordinates for d2z8la2:
Click to download the PDB-style file with coordinates for d2z8la2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2z8la2:
- d2z8la2 first appeared in SCOP 1.75
- d2z8la2 appears in SCOPe 2.07
View in 3D
