SCOP 1.75: Domain d2z8la2: 2z8l A:101-204

Lineage for d2z8la2 (2z8l A:101-204)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)

6. Protein Superantigen-like protein SET3 [75370] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [75371] (3 PDB entries)

8. Domain d2z8la2: 2z8l A:101-204 [154210]
   Other proteins in same PDB: d2z8la1
   automatically matched to d1m4va2
   complexed with fuc, gal, gol, nag, po4, sia

Details for d2z8la2

PDB Entry: 2z8l, 1.65 Å

PDB Description: crystal structure of the staphylococcal superantigen-like protein ssl5 at ph 4.6 complexed with sialyl lewis x

PDB Compounds: (A:) Exotoxin 3

SCOP Domain Sequences for d2z8la2:

Sequence; same for both SEQRES and ATOM records:

>d2z8la2 d.15.6.1 (A:101-204) Superantigen-like protein SET3 {Staphylococcus aureus [TaxId: 1280]}
ayydylnapkfvikkevdagvythvkrhyiykeevslkeldfklrqyliqnfdlykkfpk
dskikvimkdggyytfelnkklqphrmsdvidgrniekmeanir

Timeline for d2z8la2:

• d2z8la2 is new in SCOP 1.75
  
• d2z8la2 appears in SCOPe 2.01
  
• d2z8la2 appears in the current release, SCOPe 2.08