Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) Pfam PF13853. Phylogeny described in PubMed 12761335 |
Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins) |
Protein automated matches [190122] (8 species) not a true protein |
Species Halobacterium sp. [TaxId:29285] [188058] (3 PDB entries) |
Domain d2z55a_: 2z55 A: [171054] automated match to d1uaza_ complexed with 22b, l2p, ret |
PDB Entry: 2z55 (more details), 2.5 Å
SCOPe Domain Sequences for d2z55a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z55a_ f.13.1.1 (A:) automated matches {Halobacterium sp. [TaxId: 29285]} qagfdllndgrpetlwlgigtllmligtfyfiargwgvtdkeareyyaitilvpgiasaa ylamffgigvtevelasgtvldiyyaryadwlfttplllldlallakvdrvtigtligvd almivtgligalsktplarytwwlfstiaflfvlyylltslrsaaakrseevrstfntlt alvavlwtaypilwivgtegagvvglgietlafmvldvtakvgfgfvllrsrailgetea pe
Timeline for d2z55a_: