Lineage for d1uaza_ (1uaz A:)
- Root: SCOPe 2.07
Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) 
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membraneSuperfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) 
Pfam PF13853. Phylogeny described in PubMed 12761335Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins) 
Protein Archaerhodopsin-1 [90105] (1 species) Species Halobacterium sp. [TaxId:2243] [90106] (1 PDB entry) 
Domain d1uaza_: 1uaz A: [88392]
complexed with ret
Details for d1uaza_
PDB Entry: 1uaz (more details), 3.4 Å
PDB Description: Crystal structure of archaerhodopsin-1
PDB Compounds: (A:) archaerhodopsin-1SCOPe Domain Sequences for d1uaza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uaza_ f.13.1.1 (A:) Archaerhodopsin-1 {Halobacterium sp. [TaxId: 2243]}
taavgadllgdgrpetlwlgigtllmligtfyfivkgwgvtdkeareyysitilvpgias
aaylsmffgigltevqvgsemldiyyaryadwlfttplllldlallakvdrvsigtlvgv
dalmivtglvgalshtplarytwwlfsticmivvlyflatslraaakergpevastfntl
talvlvlwtaypilwiigtegagvvglgietllfmvldvtakvgfgfillrsrail
SCOPe Domain Coordinates for d1uaza_:
Click to download the PDB-style file with coordinates for d1uaza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uaza_:
- d1uaza_ first appeared in SCOP 1.65
- d1uaza_ appears in SCOPe 2.06
- d1uaza_ appears in the current release, SCOPe 2.08
View in 3D
