Lineage for d2z36a_ (2z36 A:)
- Root: SCOPe 2.02
Class a: All alpha proteins [46456] (284 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily)
multihelicalSuperfamily a.104.1: Cytochrome P450 [48264] (2 families) 
Family a.104.1.0: automated matches [191509] (1 protein)
not a true familyProtein automated matches [190847] (18 species)
not a true protein
Species Nonomuraea recticatena [TaxId:46178] [188167] (1 PDB entry) 
Domain d2z36a_: 2z36 A: [171018]
automated match to d1cl6a_
complexed with fe, hem, mes
Details for d2z36a_
PDB Entry: 2z36 (more details), 2.8 Å
PDB Description: Crystal structure of cytochrome P450 MoxA from Nonomuraea recticatena (CYP105)
PDB Compounds: (A:) Cytochrome P450 type compactin 3'',4''-hydroxylaseSCOPe Domain Sequences for d2z36a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z36a_ a.104.1.0 (A:) automated matches {Nonomuraea recticatena [TaxId: 46178]}
aglelpvergcpfappaayerlrerapinkvrltsggqawwvsgheearavladgrfssd
krkdgfplftldaatlqqlrsqpplmlgmdgaehsaarrpvigeftvkrlaalrpriqdi
vdhfiddmlatdqrpvdlvqalslpvpslvicellgvpytdhdffqsrttmmvsrtsmed
rrrafaelrayiddlitrkesepgddlfsrqiarqrqegtldhaglvslafllltaghet
tanmislgvvgllshpeqltvvkanpgrtpmaveellryftiadgvtsrlatedveiggv
sikagegvivsmlsanwdpavfkdpavldvergarhhlafgfgphqclgqnlarmelqiv
fdtlfrripslrlavpmedvpfkgdsviygvhelpvtwhhhhh
SCOPe Domain Coordinates for d2z36a_:
Click to download the PDB-style file with coordinates for d2z36a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2z36a_:
- d2z36a_ first appeared in SCOPe 2.01
- d2z36a_ appears in SCOPe 2.03
- d2z36a_ appears in the current release, SCOPe 2.08, called d2z36a1
View in 3D
