Lineage for d2z36a_ (2z36 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278156Species Nonomuraea recticatena [TaxId:46178] [188167] (1 PDB entry)
  8. 1278157Domain d2z36a_: 2z36 A: [171018]
    automated match to d1cl6a_
    complexed with fe, hem, mes

Details for d2z36a_

PDB Entry: 2z36 (more details), 2.8 Å

PDB Description: Crystal structure of cytochrome P450 MoxA from Nonomuraea recticatena (CYP105)
PDB Compounds: (A:) Cytochrome P450 type compactin 3'',4''-hydroxylase

SCOPe Domain Sequences for d2z36a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z36a_ a.104.1.0 (A:) automated matches {Nonomuraea recticatena [TaxId: 46178]}
aglelpvergcpfappaayerlrerapinkvrltsggqawwvsgheearavladgrfssd
krkdgfplftldaatlqqlrsqpplmlgmdgaehsaarrpvigeftvkrlaalrpriqdi
vdhfiddmlatdqrpvdlvqalslpvpslvicellgvpytdhdffqsrttmmvsrtsmed
rrrafaelrayiddlitrkesepgddlfsrqiarqrqegtldhaglvslafllltaghet
tanmislgvvgllshpeqltvvkanpgrtpmaveellryftiadgvtsrlatedveiggv
sikagegvivsmlsanwdpavfkdpavldvergarhhlafgfgphqclgqnlarmelqiv
fdtlfrripslrlavpmedvpfkgdsviygvhelpvtwhhhhh

SCOPe Domain Coordinates for d2z36a_:

Click to download the PDB-style file with coordinates for d2z36a_.
(The format of our PDB-style files is described here.)

Timeline for d2z36a_: