Lineage for d2ylkc_ (2ylk C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1771715Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 1771831Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 1771832Protein automated matches [191113] (6 species)
    not a true protein
  7. 1771847Species Clostridium thermocellum [TaxId:1515] [189176] (7 PDB entries)
  8. 1771858Domain d2ylkc_: 2ylk C: [195485]
    automated match to d3zuca_

Details for d2ylkc_

PDB Entry: 2ylk (more details), 2.2 Å

PDB Description: Carbohydrate-binding module CBM3b from the cellulosomal cellobiohydrolase 9A from Clostridium thermocellum
PDB Compounds: (C:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d2ylkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ylkc_ b.2.2.0 (C:) automated matches {Clostridium thermocellum [TaxId: 1515]}
dvkvqylcentqtsqqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytpi
gsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpti
kafqdygkvtlykngelvwgtppg

SCOPe Domain Coordinates for d2ylkc_:

Click to download the PDB-style file with coordinates for d2ylkc_.
(The format of our PDB-style files is described here.)

Timeline for d2ylkc_: