![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
![]() | Protein automated matches [191113] (13 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries) |
![]() | Domain d2ylkc_: 2ylk C: [195485] Other proteins in same PDB: d2ylka2 automated match to d3zuca_ |
PDB Entry: 2ylk (more details), 2.2 Å
SCOPe Domain Sequences for d2ylkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ylkc_ b.2.2.0 (C:) automated matches {Clostridium thermocellum [TaxId: 1515]} dvkvqylcentqtsqqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytpi gsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpti kafqdygkvtlykngelvwgtppg
Timeline for d2ylkc_:
![]() Domains from other chains: (mouse over for more information) d2ylka1, d2ylka2, d2ylkb_, d2ylkd_ |