Lineage for d2ykta_ (2ykt A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737998Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2737999Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2738043Family a.238.1.3: IMD domain [140703] (1 protein)
    Pfam PF08397
  6. 2738044Protein BAP2/IRSp53 N-terminal domain [140704] (1 species)
  7. 2738045Species Human (Homo sapiens) [TaxId:9606] [140705] (3 PDB entries)
    Uniprot Q9UQB8 1-248! Uniprot Q9UQB8 2-228
  8. 2738048Domain d2ykta_: 2ykt A: [170840]
    automated match to d1y2oa1
    complexed with so4

Details for d2ykta_

PDB Entry: 2ykt (more details), 2.11 Å

PDB Description: crystal structure of the i-bar domain of irsp53 (baiap2) in complex with an ehec derived tir peptide
PDB Compounds: (A:) Brain-specific angiogenesis inhibitor 1-associated protein 2

SCOPe Domain Sequences for d2ykta_:

Sequence, based on SEQRES records: (download)

>d2ykta_ a.238.1.3 (A:) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmgela
sesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaalkky
qteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvsdgy
ktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqqacadps

Sequence, based on observed residues (ATOM records): (download)

>d2ykta_ a.238.1.3 (A:) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmgela
sesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaalkky
qteqrskgdaldkcqaelkklrkkpqkysdkelqyidaisnkqgelenyvsdgyktalte
errrfcflvekqcavaknsaayhskgkellaqklplwqqacadps

SCOPe Domain Coordinates for d2ykta_:

Click to download the PDB-style file with coordinates for d2ykta_.
(The format of our PDB-style files is described here.)

Timeline for d2ykta_: