SCOPe 2.07: Domain d2ykta_: 2ykt A:

Lineage for d2ykta_ (2ykt A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.3: IMD domain [140703] (1 protein)
   Pfam PF08397

6. Protein BAP2/IRSp53 N-terminal domain [140704] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140705] (3 PDB entries)
   Uniprot Q9UQB8 1-248! Uniprot Q9UQB8 2-228

8. Domain d2ykta_: 2ykt A: [170840]
   automated match to d1y2oa1
   complexed with so4

Details for d2ykta_

PDB Entry: 2ykt, 2.11 Å

PDB Description: crystal structure of the i-bar domain of irsp53 (baiap2) in complex with an ehec derived tir peptide

PDB Compounds: (A:) Brain-specific angiogenesis inhibitor 1-associated protein 2

SCOPe Domain Sequences for d2ykta_:

Sequence, based on SEQRES records:

>d2ykta_ a.238.1.3 (A:) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmgela
sesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaalkky
qteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvsdgy
ktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqqacadps

Sequence, based on observed residues (ATOM records):

>d2ykta_ a.238.1.3 (A:) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmgela
sesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaalkky
qteqrskgdaldkcqaelkklrkkpqkysdkelqyidaisnkqgelenyvsdgyktalte
errrfcflvekqcavaknsaayhskgkellaqklplwqqacadps

Timeline for d2ykta_:

• d2ykta_ first appeared in SCOPe 2.01
  
• d2ykta_ appears in SCOPe 2.06
  
• d2ykta_ appears in the current release, SCOPe 2.08