Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d2yc1a_: 2yc1 A: [198708] Other proteins in same PDB: d2yc1b1, d2yc1b2, d2yc1c_, d2yc1e1, d2yc1e2, d2yc1f_ automated match to d3ogoh_ complexed with gol |
PDB Entry: 2yc1 (more details), 1.9 Å
SCOPe Domain Sequences for d2yc1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yc1a_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesggglvqpggslrlsctgsgftfdnyamhwlrqvpgeglewvsgisrssgdidy adsvkgrftisrddakktlslqmnslraedtavyycarggvgsfdtwgqgtmvtvss
Timeline for d2yc1a_: