Lineage for d2yc1e1 (2yc1 E:133-239)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754501Domain d2yc1e1: 2yc1 E:133-239 [198711]
    Other proteins in same PDB: d2yc1a_, d2yc1b2, d2yc1c_, d2yc1d_, d2yc1e2, d2yc1f_
    automated match to d4jvpa_
    complexed with gol

Details for d2yc1e1

PDB Entry: 2yc1 (more details), 1.9 Å

PDB Description: crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
PDB Compounds: (E:) single chain antibody fragment 9004g

SCOPe Domain Sequences for d2yc1e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yc1e1 b.1.1.0 (E:133-239) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlsvspgeratlscrasqsvrsylawyqqkpgqaprllfsdasnratgipa
rftgsgsgtdftltisslepedfaiyycqqyrysprtfgqgtkveik

SCOPe Domain Coordinates for d2yc1e1:

Click to download the PDB-style file with coordinates for d2yc1e1.
(The format of our PDB-style files is described here.)

Timeline for d2yc1e1: