Lineage for d2y43b_ (2y43 B:)
- Root: SCOPe 2.06
Class g: Small proteins [56992] (94 folds) 
Fold g.44: RING/U-box [57849] (1 superfamily)
dimetal(zinc)-bound alpha+beta motif; structurally diverseSuperfamily g.44.1: RING/U-box [57850] (7 families) 
Family g.44.1.0: automated matches [191345] (1 protein)
not a true familyProtein automated matches [190242] (3 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [189860] (5 PDB entries) 
Domain d2y43b_: 2y43 B: [170590]
automated match to d1jm7b_
complexed with zn
Details for d2y43b_
PDB Entry: 2y43 (more details), 1.8 Å
PDB Description: rad18 ubiquitin ligase ring domain structure
PDB Compounds: (B:) e3 ubiquitin-protein ligase rad18SCOPe Domain Sequences for d2y43b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y43b_ g.44.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srwppglavmktiddllrcgicfeyfniamiipqcshnycslcirkflsyktqcptccvt
vtepdlknnrildelvkslnfarnhllqf
SCOPe Domain Coordinates for d2y43b_:
Click to download the PDB-style file with coordinates for d2y43b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2y43b_:
- d2y43b_ first appeared in SCOPe 2.01
- d2y43b_ appears in SCOPe 2.05
- d2y43b_ appears in SCOPe 2.07
- d2y43b_ appears in the current release, SCOPe 2.08
View in 3D
