Lineage for d2xu3a_ (2xu3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927640Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2927641Protein automated matches [190230] (23 species)
    not a true protein
  7. 2927669Species Human (Homo sapiens) [TaxId:9606] [187072] (53 PDB entries)
  8. 2927670Domain d2xu3a_: 2xu3 A: [207338]
    automated match to d3hd3b_
    complexed with btb, cl, xu3

Details for d2xu3a_

PDB Entry: 2xu3 (more details), 0.9 Å

PDB Description: cathepsin l with a nitrile inhibitor
PDB Compounds: (A:) Cathepsin L1

SCOPe Domain Sequences for d2xu3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xu3a_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

SCOPe Domain Coordinates for d2xu3a_:

Click to download the PDB-style file with coordinates for d2xu3a_.
(The format of our PDB-style files is described here.)

Timeline for d2xu3a_: