Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) automatically mapped to Pfam PF00875 |
Family c.28.1.0: automated matches [227292] (1 protein) not a true family |
Protein automated matches [227113] (2 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231380] (6 PDB entries) |
Domain d2wb2a1: 2wb2 A:2-215 [231381] Other proteins in same PDB: d2wb2a2 automated match to d4mlpd1 protein/DNA complex; complexed with fad |
PDB Entry: 2wb2 (more details), 2.95 Å
SCOPe Domain Sequences for d2wb2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wb2a1 c.28.1.0 (A:2-215) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} dsqrstlvhwfrkglrlhdnpalshiftaanaapgryfvrpifildpgildwmqvganrw rflqqtledldnqlrklnsrlfvvrgkpaevfprifkswrvemltfetdiepysvtrdaa vqklakaegvrvethcshtiynpelviaknlgkapityqkflgiveqlkvpkvlgvpekl knmptppkdeveqkdsaaydcptmkqlvkrpeel
Timeline for d2wb2a1: