Lineage for d2wb2a1 (2wb2 A:2-215)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1360394Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 1360395Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 1360427Family c.28.1.0: automated matches [227292] (1 protein)
    not a true family
  6. 1360428Protein automated matches [227113] (2 species)
    not a true protein
  7. 1360429Species Drosophila melanogaster [TaxId:7227] [231380] (1 PDB entry)
  8. 1360430Domain d2wb2a1: 2wb2 A:2-215 [231381]
    Other proteins in same PDB: d2wb2a2
    automated match to d4mlpd1
    protein/DNA complex; complexed with fad

Details for d2wb2a1

PDB Entry: 2wb2 (more details), 2.95 Å

PDB Description: drosophila melanogaster (6-4) photolyase bound to double stranded dna containing a t(6-4)c photolesion
PDB Compounds: (A:) photolyase

SCOPe Domain Sequences for d2wb2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wb2a1 c.28.1.0 (A:2-215) automated matches {Drosophila melanogaster [TaxId: 7227]}
dsqrstlvhwfrkglrlhdnpalshiftaanaapgryfvrpifildpgildwmqvganrw
rflqqtledldnqlrklnsrlfvvrgkpaevfprifkswrvemltfetdiepysvtrdaa
vqklakaegvrvethcshtiynpelviaknlgkapityqkflgiveqlkvpkvlgvpekl
knmptppkdeveqkdsaaydcptmkqlvkrpeel

SCOPe Domain Coordinates for d2wb2a1:

Click to download the PDB-style file with coordinates for d2wb2a1.
(The format of our PDB-style files is described here.)

Timeline for d2wb2a1: