SCOPe 2.08: Domain d2wb2a1: 2wb2 A:2-215

Lineage for d2wb2a1 (2wb2 A:2-215)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families)
   automatically mapped to Pfam PF00875

5. Family c.28.1.0: automated matches [227292] (1 protein)
   not a true family

6. Protein automated matches [227113] (4 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231380] (8 PDB entries)

8. Domain d2wb2a1: 2wb2 A:2-215 [231381]
   Other proteins in same PDB: d2wb2a2
   automated match to d4mlpd1
   protein/DNA complex; complexed with fad

Details for d2wb2a1

PDB Entry: 2wb2, 2.95 Å

PDB Description: drosophila melanogaster (6-4) photolyase bound to double stranded dna containing a t(6-4)c photolesion

PDB Compounds: (A:) photolyase

SCOPe Domain Sequences for d2wb2a1:

Sequence; same for both SEQRES and ATOM records:

>d2wb2a1 c.28.1.0 (A:2-215) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dsqrstlvhwfrkglrlhdnpalshiftaanaapgryfvrpifildpgildwmqvganrw
rflqqtledldnqlrklnsrlfvvrgkpaevfprifkswrvemltfetdiepysvtrdaa
vqklakaegvrvethcshtiynpelviaknlgkapityqkflgiveqlkvpkvlgvpekl
knmptppkdeveqkdsaaydcptmkqlvkrpeel

Timeline for d2wb2a1:

• d2wb2a1 first appeared in SCOPe 2.03
  
• d2wb2a1 appears in SCOPe 2.07