Lineage for d2v5wb_ (2v5w B:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) 
Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
automatically mapped to Pfam PF00850Protein automated matches [190786] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188039] (20 PDB entries) 
Domain d2v5wb_: 2v5w B: [168358]
automated match to d1t64a_
complexed with k, zn
Details for d2v5wb_
PDB Entry: 2v5w (more details), 2 Å
PDB Description: crystal structure of hdac8-substrate complex
PDB Compounds: (B:) Histone deacetylase 8SCOPe Domain Sequences for d2v5wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v5wb_ c.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgqslvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeemat
fhtdaylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidg
mckvainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedaf
sftskvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlk
evyqafnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggfnla
ntarcwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyi
kgnlkhv
SCOPe Domain Coordinates for d2v5wb_:
Click to download the PDB-style file with coordinates for d2v5wb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2v5wb_:
- d2v5wb_ first appeared in SCOPe 2.01
- d2v5wb_ appears in SCOPe 2.03
- d2v5wb_ appears in SCOPe 2.05
- d2v5wb_ appears in the current release, SCOPe 2.08
View in 3D
