Lineage for d2rnya1 (2rny A:1077-1197)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1267072Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1267073Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1267074Family a.29.2.1: Bromodomain [47371] (5 proteins)
  6. Protein CREB-binding protein, CBP [74712] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [74713] (5 PDB entries)
  8. 1267081Domain d2rnya1: 2rny A:1077-1197 [152175]
    automatically matched to d1jspb_
    protein/DNA complex

Details for d2rnya1

PDB Entry: 2rny (more details)

PDB Description: complex structures of cbp bromodomain with h4 ack20 peptide
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d2rnya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rnya1 a.29.2.1 (A:1077-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls
tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
g

SCOPe Domain Coordinates for d2rnya1:

Click to download the PDB-style file with coordinates for d2rnya1.
(The format of our PDB-style files is described here.)

Timeline for d2rnya1: