PDB entry 2rny

View 2rny on RCSB PDB site
Description: Complex Structures of CBP Bromodomain with H4 ack20 Peptide
Class: transferase/nuclear protein
Keywords: Bromodomain, Histone, CREB, CBP, p53, Acetylation, Activator, Chromosomal rearrangement, Disease mutation, Host-virus interaction, Metal-binding, Methylation, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Transferase, Zinc, Zinc-finger, Chromosomal protein, DNA-binding, Nucleosome core, TRANSFERASE/NUCLEAR PROTEIN COMPLEX
Deposited on 2008-02-03, released 2008-05-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92793 (4-120)
      • expression tag (0-3)
    Domains in SCOPe 2.03: d2rnya1
  • Chain 'B':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rnyA (A:)
    gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls
    tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
    g
    

  • Chain 'B':
    No sequence available.