Lineage for d2rnya2 (2rny A:1081-1197)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706696Protein CREB-binding protein, CBP [74712] (2 species)
  7. 2706697Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries)
  8. 2706787Domain d2rnya2: 2rny A:1081-1197 [152175]
    Other proteins in same PDB: d2rnya3
    automated match to d2rnya1
    protein/DNA complex

Details for d2rnya2

PDB Entry: 2rny (more details)

PDB Description: complex structures of cbp bromodomain with h4 ack20 peptide
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d2rnya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rnya2 a.29.2.1 (A:1081-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

SCOPe Domain Coordinates for d2rnya2:

Click to download the PDB-style file with coordinates for d2rnya2.
(The format of our PDB-style files is described here.)

Timeline for d2rnya2: