Lineage for d2rmca_ (2rmc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806648Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2806868Species Mouse (Mus musculus), variant C [TaxId:10090] [50897] (1 PDB entry)
  8. 2806869Domain d2rmca_: 2rmc A: [27491]

Details for d2rmca_

PDB Entry: 2rmc (more details), 1.64 Å

PDB Description: crystal structure of murine cyclophilin c complexed with immunosuppressive drug cyclosporin a
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase c

SCOPe Domain Sequences for d2rmca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]}
krgpsvtdkvffdvrigdkdvgriviglfgnvvpktvenfvalatgekgygykgsifhrv
ikdfmiqggdftardgtggmsiygetfpdenfklkhygigwvsmanagpdtngsqffitl
tkptwldgkhvvfgkvldgmtvvhsielqatdghdrpltdctivnsgkidvktpfvvevp
dw

SCOPe Domain Coordinates for d2rmca_:

Click to download the PDB-style file with coordinates for d2rmca_.
(The format of our PDB-style files is described here.)

Timeline for d2rmca_: