Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (57 species) not a true protein |
Species Hahella chejuensis [TaxId:158327] [188235] (1 PDB entry) |
Domain d2rfgb_: 2rfg B: [168082] automated match to d1dhpa_ complexed with eoh, mg |
PDB Entry: 2rfg (more details), 1.5 Å
SCOPe Domain Sequences for d2rfgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rfgb_ c.1.10.0 (B:) automated matches {Hahella chejuensis [TaxId: 158327]} mfrgsliamitpfingqvdekalaglvdwqikhgahglvpvgttgesptlteeehkrvva lvaeqaqgrvpviagagsnnpveavryaqhaqqagadavlcvagyynrpsqeglyqhfkm vhdaidipiivynippravvdikpetmarlaalprivgvkdattdlarisrermlinkpf sflsgddmtaiaynasggqgcisvsaniapalygqmqtatlqgdfrealrihdllaplhe alfrepspagakyaasllglcneecrlpivplseqtksdikniinelyrlehhhhhh
Timeline for d2rfgb_: