Lineage for d1dhpa_ (1dhp A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1571861Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1571990Protein Dihydrodipicolinate synthase [51574] (12 species)
  7. 1572020Species Escherichia coli [TaxId:562] [51575] (15 PDB entries)
  8. 1572049Domain d1dhpa_: 1dhp A: [29097]
    complexed with k

Details for d1dhpa_

PDB Entry: 1dhp (more details), 2.3 Å

PDB Description: dihydrodipicolinate synthase
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d1dhpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dhpa_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

SCOPe Domain Coordinates for d1dhpa_:

Click to download the PDB-style file with coordinates for d1dhpa_.
(The format of our PDB-style files is described here.)

Timeline for d1dhpa_: