Class b: All beta proteins [48724] (176 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins) Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals |
Protein Uncharacterized protein YgdI [159055] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [159056] (1 PDB entry) Uniprot Q7CPV8 23-75 |
Domain d2ra2a1: 2ra2 A:4-56 [151811] |
PDB Entry: 2ra2 (more details), 1.9 Å
SCOPe Domain Sequences for d2ra2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ra2a1 b.38.1.6 (A:4-56) Uncharacterized protein YgdI {Salmonella typhimurium [TaxId: 90371]} pnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalen
Timeline for d2ra2a1: