SCOPe 2.03: Domain d2ra2a1: 2ra2 A:4-56

Lineage for d2ra2a1 (2ra2 A:4-56)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins)
   Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals

6. Protein Uncharacterized protein YgdI [159055] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [159056] (1 PDB entry)
   Uniprot Q7CPV8 23-75

8. Domain d2ra2a1: 2ra2 A:4-56 [151811]

Details for d2ra2a1

PDB Entry: 2ra2, 1.9 Å

PDB Description: X-Ray structure of the Q7CPV8 protein from Salmonella typhimurium at the resolution 1.9 A. Northeast Structural Genomics Consortium target StR88A

PDB Compounds: (A:) Putative lipoprotein

SCOPe Domain Sequences for d2ra2a1:

Sequence; same for both SEQRES and ATOM records:

>d2ra2a1 b.38.1.6 (A:4-56) Uncharacterized protein YgdI {Salmonella typhimurium [TaxId: 90371]}
pnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalen

Timeline for d2ra2a1:

• d2ra2a1 first appeared in SCOP 1.75
  
• d2ra2a1 appears in SCOPe 2.02
  
• d2ra2a1 appears in SCOPe 2.04
  
• d2ra2a1 appears in the current release, SCOPe 2.08