SCOPe 2.08: Domain d2ozka1: 2ozk A:27-190

Lineage for d2ozka1 (2ozk A:27-190)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)
Family c.66.1.48: Nsp15 N-terminal domain-like [142625] (2 proteins)
rudiment methyltransferase fold that probably has lost the enzymatic activity; contains extra N-terminal alpha+beta subdomain
Protein Nsp15 [142626] (2 species)
Species SARS coronavirus [TaxId:227859] [142628] (3 PDB entries)
Uniprot Q6VA80 6619-6774
Domain d2ozka1: 2ozk A:27-190 [149107]
Other proteins in same PDB: d2ozka2, d2ozkb2, d2ozkc2, d2ozkd2

Details for d2ozka1

PDB Entry: 2ozk (more details), 2.9 Å

PDB Description: structure of an n-terminal truncated form of nendou (nsp15) from sars-coronavirus

PDB Compounds: (A:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d2ozka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ozka1 c.66.1.48 (A:27-190) Nsp15 {SARS coronavirus [TaxId: 227859]}
innavytkvdgidveifenkttlpvnvafelwakrnikpvpeikilnnlgvdiaantviw
dykreapahvstigvctmtdiakkptesacssltvlfdgrvegqvdlfrnarngvliteg
svkgltpskgpaqasvngvtligesvktqfnyfkkvdgiiqqlp

SCOPe Domain Coordinates for d2ozka1:

Click to download the PDB-style file with coordinates for d2ozka1.
(The format of our PDB-style files is described here.)

Timeline for d2ozka1: