Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein Cyclic AMP receptor-like protein Vfr [159312] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [159313] (1 PDB entry) Uniprot P55222 9-142 |
Domain d2oz6a2: 2oz6 A:9-142 [149104] Other proteins in same PDB: d2oz6a1 protein/DNA complex; complexed with cmp |
PDB Entry: 2oz6 (more details), 2.8 Å
SCOPe Domain Sequences for d2oz6a2:
Sequence, based on SEQRES records: (download)
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} klkhldkllahchrrrytakstiiyagdrcetlffiikgsvtiliedddgremiigylns gdffgelglfekegseqersawvrakvecevaeisyakfrelsqqdseilytlgsqmadr lrkttrkvgdlafl
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} klkhldkllahchrrrytakstiiyagdrcetlffiikgsvtiliedddgremiigylns gdffgelglfeqersawvrakvecevaeisyakfrelsqqdseilytlgsqmadrlrktt rkvgdlafl
Timeline for d2oz6a2: