Lineage for d2oz6a2 (2oz6 A:9-142)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 810399Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 810405Family b.82.3.2: cAMP-binding domain [51210] (12 proteins)
    Pfam PF00027
  6. 810458Protein Cyclic AMP receptor-like protein Vfr [159312] (1 species)
  7. 810459Species Pseudomonas aeruginosa [TaxId:287] [159313] (1 PDB entry)
    Uniprot P55222 9-142
  8. 810460Domain d2oz6a2: 2oz6 A:9-142 [149104]
    Other proteins in same PDB: d2oz6a1
    complexed with cmp

Details for d2oz6a2

PDB Entry: 2oz6 (more details), 2.8 Å

PDB Description: crystal structure of virulence factor regulator from pseudomonas aeruginosa in complex with camp
PDB Compounds: (A:) Virulence Factor Regulator

SCOP Domain Sequences for d2oz6a2:

Sequence, based on SEQRES records: (download)

>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]}
klkhldkllahchrrrytakstiiyagdrcetlffiikgsvtiliedddgremiigylns
gdffgelglfekegseqersawvrakvecevaeisyakfrelsqqdseilytlgsqmadr
lrkttrkvgdlafl

Sequence, based on observed residues (ATOM records): (download)

>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]}
klkhldkllahchrrrytakstiiyagdrcetlffiikgsvtiliedddgremiigylns
gdffgelglfeqersawvrakvecevaeisyakfrelsqqdseilytlgsqmadrlrktt
rkvgdlafl

SCOP Domain Coordinates for d2oz6a2:

Click to download the PDB-style file with coordinates for d2oz6a2.
(The format of our PDB-style files is described here.)

Timeline for d2oz6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oz6a1