Lineage for d2ouxa1 (2oux A:6-135)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340576Superfamily a.118.26: MgtE N-terminal domain-like [158791] (2 families) (S)
    made of short helices; approximately 2.5 helices per turn of superhelix
    automatically mapped to Pfam PF03448
  5. 2340577Family a.118.26.1: MgtE N-terminal domain-like [158792] (1 protein)
    Pfam PF03448
  6. 2340578Protein Magnesium transporter MgtE [158793] (2 species)
  7. 2340579Species Enterococcus faecalis [TaxId:1351] [158794] (1 PDB entry)
    Uniprot Q830V1 6-135
  8. 2340580Domain d2ouxa1: 2oux A:6-135 [149031]
    Other proteins in same PDB: d2ouxa2, d2ouxb2
    complexed with mg

Details for d2ouxa1

PDB Entry: 2oux (more details), 2.16 Å

PDB Description: crystal structure of the soluble part of a magnesium transporter
PDB Compounds: (A:) Magnesium transporter

SCOPe Domain Sequences for d2ouxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ouxa1 a.118.26.1 (A:6-135) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]}
emeeqfallletlknqqmnefrelflalhiyeqgqfyqsldekdrqhlynylspkeladm
fdvieednenmkdylaemrpsyaadmlaemytdnavdllnmldksqkakylsllsseeag
eikellhyed

SCOPe Domain Coordinates for d2ouxa1:

Click to download the PDB-style file with coordinates for d2ouxa1.
(The format of our PDB-style files is described here.)

Timeline for d2ouxa1:

2340580
d2ouxa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2ouxa2