![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.26: MgtE N-terminal domain-like [158791] (2 families) ![]() made of short helices; approximately 2.5 helices per turn of superhelix automatically mapped to Pfam PF03448 |
![]() | Family a.118.26.1: MgtE N-terminal domain-like [158792] (1 protein) Pfam PF03448 |
![]() | Protein Magnesium transporter MgtE [158793] (2 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [158794] (1 PDB entry) Uniprot Q830V1 6-135 |
![]() | Domain d2ouxa1: 2oux A:6-135 [149031] Other proteins in same PDB: d2ouxa2, d2ouxb2 complexed with mg |
PDB Entry: 2oux (more details), 2.16 Å
SCOPe Domain Sequences for d2ouxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ouxa1 a.118.26.1 (A:6-135) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} emeeqfallletlknqqmnefrelflalhiyeqgqfyqsldekdrqhlynylspkeladm fdvieednenmkdylaemrpsyaadmlaemytdnavdllnmldksqkakylsllsseeag eikellhyed
Timeline for d2ouxa1: