Lineage for d2ok9a_ (2ok9 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346343Protein automated matches [190139] (27 species)
    not a true protein
  7. 2346387Species Bothrops pirajai [TaxId:113192] [188615] (4 PDB entries)
  8. 2346394Domain d2ok9a_: 2ok9 A: [166726]
    automated match to d1qlla_
    complexed with ipa, pbp

Details for d2ok9a_

PDB Entry: 2ok9 (more details), 2.34 Å

PDB Description: prtx-i-bpb
PDB Compounds: (A:) Phospholipase A2 homolog 1

SCOPe Domain Sequences for d2ok9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ok9a_ a.133.1.2 (A:) automated matches {Bothrops pirajai [TaxId: 113192]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynklyryhlkpfckkadd
c

SCOPe Domain Coordinates for d2ok9a_:

Click to download the PDB-style file with coordinates for d2ok9a_.
(The format of our PDB-style files is described here.)

Timeline for d2ok9a_: