Lineage for d2o9ba1 (2o9b A:135-321)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576707Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2576708Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 2576713Protein Bacteriophytochrome BphP [160661] (3 species)
  7. 2576714Species Deinococcus radiodurans [TaxId:1299] [160663] (7 PDB entries)
    Uniprot Q9RZA4 135-321! Uniprot Q9RZA4 137-325
  8. 2576720Domain d2o9ba1: 2o9b A:135-321 [148682]
    Other proteins in same PDB: d2o9ba2, d2o9ba3
    complexed with lbv

Details for d2o9ba1

PDB Entry: 2o9b (more details), 2.15 Å

PDB Description: crystal structure of bacteriophytochrome chromophore binding domain
PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d2o9ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o9ba1 d.110.2.1 (A:135-321) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]}
tgphalrnamfalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreg
lhaflghrfpasdipaqaralytrhllrltadtraaavpldpvlnpqtnaptplggavlr
atspmhmqylrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleslgrllsl
qvqvkea

SCOPe Domain Coordinates for d2o9ba1:

Click to download the PDB-style file with coordinates for d2o9ba1.
(The format of our PDB-style files is described here.)

Timeline for d2o9ba1: