SCOP 1.75: Domain d2o9ba1: 2o9b A:135-321

Lineage for d2o9ba1 (2o9b A:135-321)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (4 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.1: GAF domain [55782] (7 proteins)

6. Protein Bacteriophytochrome BphP [160661] (2 species)

7. Species Deinococcus radiodurans [TaxId:1299] [160663] (3 PDB entries)
   Uniprot Q9RZA4 135-321! Uniprot Q9RZA4 137-325

8. Domain d2o9ba1: 2o9b A:135-321 [148682]
   Other proteins in same PDB: d2o9ba2
   complexed with lbv; mutant

Details for d2o9ba1

PDB Entry: 2o9b, 2.15 Å

PDB Description: crystal structure of bacteriophytochrome chromophore binding domain

PDB Compounds: (A:) Bacteriophytochrome

SCOP Domain Sequences for d2o9ba1:

Sequence; same for both SEQRES and ATOM records:

>d2o9ba1 d.110.2.1 (A:135-321) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]}
tgphalrnamfalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreg
lhaflghrfpasdipaqaralytrhllrltadtraaavpldpvlnpqtnaptplggavlr
atspmhmqylrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleslgrllsl
qvqvkea

Timeline for d2o9ba1:

• d2o9ba1 is new in SCOP 1.75
  
• d2o9ba1 appears in SCOPe 2.01
  
• d2o9ba1 appears in the current release, SCOPe 2.08