Lineage for d2o6qa_ (2o6q A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851922Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2851923Protein automated matches [190787] (14 species)
    not a true protein
  7. 2851981Species Inshore hagfish (Eptatretus burgeri) [TaxId:7764] [193205] (3 PDB entries)
  8. 2851985Domain d2o6qa_: 2o6q A: [243304]
    automated match to d4cnma_

Details for d2o6qa_

PDB Entry: 2o6q (more details), 2.5 Å

PDB Description: Structural diversity of the hagfish Variable Lymphocyte Receptors A29
PDB Compounds: (A:) Variable lymphocyte receptor A

SCOPe Domain Sequences for d2o6qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6qa_ c.10.2.0 (A:) automated matches {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}
nealckkdggvcscnnnknsvdcsskkltaipsnipadtkkldlqsnklsslpskafhrl
tklrllylndnklqtlpagifkelknletlwvtdnklqalpigvfdqlvnlaelrldrnq
lkslpprvfdsltkltylslgynelqslpkgvfdkltslkelrlynnqlkrvpegafdkl
telktlkldnnqlkrvpegafdsleklkmlqlqenpwdctcngiiymakwlkkkadeglg
gvdtagcekggkavleitekdaasdcvspn

SCOPe Domain Coordinates for d2o6qa_:

Click to download the PDB-style file with coordinates for d2o6qa_.
(The format of our PDB-style files is described here.)

Timeline for d2o6qa_: