Lineage for d2nyha1 (2nyh A:1-115)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955919Superfamily d.58.55: DOPA-like [143410] (2 families) (S)
    probable biological unit is homodimer; the extra C-terminal strand, adjacent and antiparallel to strand 4, contributes to the dimerisation interface
  5. 2955920Family d.58.55.1: DOPA dioxygenase-like [143411] (1 protein)
    Pfam PF08883
  6. 2955921Protein Putative dioxygenase BxeB0224 [143412] (1 species)
    Bxeno_B2751
  7. 2955922Species Burkholderia xenovorans [TaxId:36873] [143413] (2 PDB entries)
    Uniprot Q13JM0 1-115
  8. 2955927Domain d2nyha1: 2nyh A:1-115 [138813]
    Other proteins in same PDB: d2nyha2
    complexed with so4

Details for d2nyha1

PDB Entry: 2nyh (more details), 1.7 Å

PDB Description: crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.70 a resolution
PDB Compounds: (A:) Putative dioxygenase

SCOPe Domain Sequences for d2nyha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nyha1 d.58.55.1 (A:1-115) Putative dioxygenase BxeB0224 {Burkholderia xenovorans [TaxId: 36873]}
mtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsyq
laftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsal

SCOPe Domain Coordinates for d2nyha1:

Click to download the PDB-style file with coordinates for d2nyha1.
(The format of our PDB-style files is described here.)

Timeline for d2nyha1:

2955927
d2nyha1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2nyha2
2955927
d2nyha1 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d2nyhb_