SCOP 1.73: Domain d2nyha1: 2nyh A:1-115

Lineage for d2nyha1 (2nyh A:1-115)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.55: DOPA-like [143410] (1 family)
   probable biological unit is homodimer; the extra C-terminal strand, adjacent and antiparallel to strand 4, contributes to the dimerisation interface

5. Family d.58.55.1: DOPA dioxygenase-like [143411] (1 protein)
   Pfam PF08883

6. Protein Putative dioxygenase BxeB0224 [143412] (1 species)
   Bxeno_B2751

7. Species Burkholderia xenovorans [TaxId:36873] [143413] (2 PDB entries)

8. Domain d2nyha1: 2nyh A:1-115 [138813]
   complexed with so4

Details for d2nyha1

PDB Entry: 2nyh, 1.7 Å

PDB Description: crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.70 a resolution

PDB Compounds: (A:) Putative dioxygenase

SCOP Domain Sequences for d2nyha1:

Sequence; same for both SEQRES and ATOM records:

>d2nyha1 d.58.55.1 (A:1-115) Putative dioxygenase BxeB0224 {Burkholderia xenovorans [TaxId: 36873]}
mtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsyq
laftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsal

Timeline for d2nyha1:

• d2nyha1 is new in SCOP 1.73
  
• d2nyha1 appears in SCOP 1.75
  
• d2nyha1 appears in the current release, SCOPe 2.08