PDB entry 2nyh

View 2nyh on RCSB PDB site
Description: Crystal structure of putative dioxygenase (YP_555069.1) from Burkholderia Xenovorans LB400 at 1.70 A resolution
Class: oxidoreductase
Keywords: YP_555069.1, putative Dioxygenase, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, OXIDOREDUCTASE
Deposited on 2006-11-20, released 2006-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative dioxygenase
    Species: Burkholderia xenovorans [TaxId:36873]
    Gene: YP_555069.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13JM0 (1-End)
      • leader sequence (0)
      • modified residue (1)
      • leader sequence (56)
      • modified residue (56)
    Domains in SCOPe 2.08: d2nyha1, d2nyha2
  • Chain 'B':
    Compound: Putative dioxygenase
    Species: Burkholderia xenovorans [TaxId:36873]
    Gene: YP_555069.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13JM0 (1-End)
      • modified residue (1)
      • leader sequence (56)
      • modified residue (56)
    Domains in SCOPe 2.08: d2nyhb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nyhA (A:)
    gmtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsy
    qlaftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsaln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nyhA (A:)
    gmtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsy
    qlaftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nyhB (B:)
    gmtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsy
    qlaftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsaln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nyhB (B:)
    mtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsyq
    laftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsal