Lineage for d2nybc2 (2nyb C:83-192)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) 
automatically mapped to Pfam PF02777Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) 
Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) Species Escherichia coli [TaxId:562] [54727] (5 PDB entries) 
Domain d2nybc2: 2nyb C:83-192 [138809]
Other proteins in same PDB: d2nyba1, d2nybb1, d2nybc1, d2nybd1
automated match to d2nyba2
complexed with fe2, o
Details for d2nybc2
PDB Entry: 2nyb (more details), 1.1 Å
PDB Description: crystal structure of e.coli iron superoxide dismutase q69e at 1.1 angstrom resolution
PDB Compounds: (C:) superoxide dismutase [fe]SCOPe Domain Sequences for d2nybc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nybc2 d.44.1.1 (C:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]}
naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag
tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa
SCOPe Domain Coordinates for d2nybc2:
Click to download the PDB-style file with coordinates for d2nybc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2nybc2:
- d2nybc2 first appeared in SCOP 1.73
- d2nybc2 appears in SCOPe 2.07
View in 3D
