Lineage for d2nybc2 (2nyb C:83-192)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722119Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 722120Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 722121Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 722149Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 722198Species Escherichia coli [TaxId:562] [54727] (6 PDB entries)
  8. 722201Domain d2nybc2: 2nyb C:83-192 [138809]
    Other proteins in same PDB: d2nyba1, d2nybb1, d2nybc1, d2nybd1
    automatically matched to d1isaa2
    complexed with fe2, o; mutant

Details for d2nybc2

PDB Entry: 2nyb (more details), 1.1 Å

PDB Description: crystal structure of e.coli iron superoxide dismutase q69e at 1.1 angstrom resolution
PDB Compounds: (C:) superoxide dismutase [fe]

SCOP Domain Sequences for d2nybc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nybc2 d.44.1.1 (C:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]}
naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag
tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa

SCOP Domain Coordinates for d2nybc2:

Click to download the PDB-style file with coordinates for d2nybc2.
(The format of our PDB-style files is described here.)

Timeline for d2nybc2: