Lineage for d2nyba2 (2nyb A:83-192)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. Species Escherichia coli [TaxId:562] [54727] (5 PDB entries)
  8. Domain d2nyba2: 2nyb A:83-192 [138805]
    Other proteins in same PDB: d2nyba1, d2nybb1, d2nybc1, d2nybd1
    automated match to d2nyba2
    complexed with fe2, o

Details for d2nyba2

PDB Entry: 2nyb (more details), 1.1 Å

PDB Description: crystal structure of e.coli iron superoxide dismutase q69e at 1.1 angstrom resolution
PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d2nyba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nyba2 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]}
naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag
tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa

SCOPe Domain Coordinates for d2nyba2 are not available.

Timeline for d2nyba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nyba1
View in 3D
Domains from other chains:
(mouse over for more information)
d2nybb1, d2nybb2, d2nybc1, d2nybc2, d2nybd1, d2nybd2