Lineage for d2nw2b2 (2nw2 B:119-247)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754302Domain d2nw2b2: 2nw2 B:119-247 [205200]
    Other proteins in same PDB: d2nw2a2
    automated match to d1lp9f2

Details for d2nw2b2

PDB Entry: 2nw2 (more details), 1.4 Å

PDB Description: Crystal structure of ELS4 TCR at 1.4A
PDB Compounds: (B:) ELS4 TCR beta chain

SCOPe Domain Sequences for d2nw2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nw2b2 b.1.1.0 (B:119-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d2nw2b2:

Click to download the PDB-style file with coordinates for d2nw2b2.
(The format of our PDB-style files is described here.)

Timeline for d2nw2b2:

2754302
d2nw2b2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2nw2b1