![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein T-cell antigen receptor [49125] (7 species) |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries) |
![]() | Domain d1lp9f2: 1lp9 F:118-245 [91089] Other proteins in same PDB: d1lp9a1, d1lp9a2, d1lp9b1, d1lp9b2, d1lp9e1, d1lp9f1, d1lp9h1, d1lp9h2, d1lp9i1, d1lp9i2, d1lp9l1, d1lp9m1 |
PDB Entry: 1lp9 (more details), 2 Å
SCOPe Domain Sequences for d1lp9f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lp9f2 b.1.1.2 (F:118-245) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea wgra
Timeline for d1lp9f2: