Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d1lp9i1: 1lp9 I:1-99 [91092] Other proteins in same PDB: d1lp9a1, d1lp9a2, d1lp9b2, d1lp9e1, d1lp9e2, d1lp9f1, d1lp9f2, d1lp9h1, d1lp9h2, d1lp9i2, d1lp9l1, d1lp9l2, d1lp9m1, d1lp9m2 |
PDB Entry: 1lp9 (more details), 2 Å
SCOPe Domain Sequences for d1lp9i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lp9i1 b.1.1.2 (I:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1lp9i1: