SCOPe 2.08: Domain d2nw2a1: 2nw2 A:1-117

Lineage for d2nw2a1 (2nw2 A:1-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2nw2a1: 2nw2 A:1-117 [205197]
   Other proteins in same PDB: d2nw2a2
   automated match to d2esvd1

Details for d2nw2a1

PDB Entry: 2nw2, 1.4 Å

PDB Description: Crystal structure of ELS4 TCR at 1.4A

PDB Compounds: (A:) ELS4 TCR alpha chain

SCOPe Domain Sequences for d2nw2a1:

Sequence, based on SEQRES records:

>d2nw2a1 b.1.1.0 (A:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavqasggsyiptfgrgtslivhpy

Sequence, based on observed residues (ATOM records):

>d2nw2a1 b.1.1.0 (A:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavqaggsyiptfgrgtslivhpy

Timeline for d2nw2a1:

• d2nw2a1 first appeared in SCOPe 2.03
  
• d2nw2a1 appears in SCOPe 2.07