Class a: All alpha proteins [46456] (289 folds) |
Fold a.272: YqgQ-like [158378] (1 superfamily) 3 helices, bundle, left-handed twist, extended overside connection between the first and second helices |
Superfamily a.272.1: YqgQ-like [158379] (1 family) automatically mapped to Pfam PF06014 |
Family a.272.1.1: YqgQ-like [158380] (1 protein) Pfam PF06014; DUF910 |
Protein Hypothetical protein YqgQ [158381] (1 species) |
Species Bacillus subtilis [TaxId:1423] [158382] (1 PDB entry) Uniprot P54494 1-62 |
Domain d2nn4a1: 2nn4 A:2-62 [148291] Other proteins in same PDB: d2nn4a2, d2nn4b3, d2nn4c3 |
PDB Entry: 2nn4 (more details), 2.1 Å
SCOPe Domain Sequences for d2nn4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nn4a1 a.272.1.1 (A:2-62) Hypothetical protein YqgQ {Bacillus subtilis [TaxId: 1423]} ntfydvqqllktfghivyfgdreleiefmldelkelymnhmiekeqwaraaavlrkeleq t
Timeline for d2nn4a1:
View in 3D Domains from other chains: (mouse over for more information) d2nn4b2, d2nn4b3, d2nn4c2, d2nn4c3 |