SCOPe 2.08: Domain d2nn4a1: 2nn4 A:2-62

Lineage for d2nn4a1 (2nn4 A:2-62)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.272: YqgQ-like [158378] (1 superfamily)
   3 helices, bundle, left-handed twist, extended overside connection between the first and second helices

4. Superfamily a.272.1: YqgQ-like [158379] (1 family)
   automatically mapped to Pfam PF06014

5. Family a.272.1.1: YqgQ-like [158380] (1 protein)
   Pfam PF06014; DUF910

6. Protein Hypothetical protein YqgQ [158381] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [158382] (1 PDB entry)
   Uniprot P54494 1-62

8. Domain d2nn4a1: 2nn4 A:2-62 [148291]
   Other proteins in same PDB: d2nn4a2, d2nn4b3, d2nn4c3

Details for d2nn4a1

PDB Entry: 2nn4, 2.1 Å

PDB Description: crystal structure of bacillus subtilis yqgq, pfam duf910

PDB Compounds: (A:) Hypothetical protein yqgQ

SCOPe Domain Sequences for d2nn4a1:

Sequence; same for both SEQRES and ATOM records:

>d2nn4a1 a.272.1.1 (A:2-62) Hypothetical protein YqgQ {Bacillus subtilis [TaxId: 1423]}
ntfydvqqllktfghivyfgdreleiefmldelkelymnhmiekeqwaraaavlrkeleq
t

Timeline for d2nn4a1:

• d2nn4a1 first appeared in SCOP 1.75
  
• d2nn4a1 appears in SCOPe 2.07