Lineage for d2m8la1 (2m8l A:1-147)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003180Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2003181Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2003182Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2003221Protein HIV-1 capsid protein [47945] (1 species)
  7. 2003222Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)
  8. 2003311Domain d2m8la1: 2m8l A:1-147 [243140]
    Other proteins in same PDB: d2m8la2, d2m8lb2
    automated match to d3ntea1

Details for d2m8la1

PDB Entry: 2m8l (more details)

PDB Description: hiv capsid dimer structure
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d2m8la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m8la1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d2m8la1:

Click to download the PDB-style file with coordinates for d2m8la1.
(The format of our PDB-style files is described here.)

Timeline for d2m8la1:

2003311
d2m8la1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2m8la2